Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin

Instruction Manual!

Product name:	Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Placentin is produced by our Mammalian expression system and the target gene encoding Ala26-Thr139 is expressed with a 6His tag at the C-terminus.
Names	Early Placenta Insulin-Like Peptide, EPIL, Insulin-Like Peptide 4, Placentin, INSL4
Accession #	Q14641
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl,pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLS PELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH
Background	Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.