Recombinant Human Apolipoprotein A-IV/ApoA4

Instruction Manual!

Product name:	Recombinant Human Apolipoprotein A-IV/ApoA4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Apolipoprotein A-IV is produced by our Mammalian expression system and the target gene encoding Glu21-Ser396 is expressed with a 6His tag at the C-terminus.
Names	Apolipoprotein A-IV, Apo-AIV, ApoA-IV, Apolipoprotein A4, APOA4
Accession #	P06727
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFAT ELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQA EQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQT VEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRG NTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEK DLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLESVDHHHHHH
Background	Apolipoprotein A4 (APOA4) is a secreted protein that belongs to the apolipoprotein A1/A4/E family. Apoa-IV is a major component of HDL and chylomicrons. APOA4 is secreted into circulation on the surface of newly synthesized chylomicron particles. APOA4 play a role in the regulation of appetite and satiety in rodent models. APOA4 involved in chylomicrons and VLDL secretion and catabolism and required for efficient activation of lipoprotein lipase by ApoC-II. In addition, APOA4 is a potent activator of lecithin-cholesterol acyltransferase in vitro.