Recombinant Human Dentin Matrix Acidic Phosphoprotein 1/DMP-1

Instruction Manual!

Product name:	Recombinant Human Dentin Matrix Acidic Phosphoprotein 1/DMP-1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Dentin matrix protein 1 is produced by our Mammalian expression system and the target gene encoding Lys17-Tyr513 is expressed with a 6His tag at the C-terminus.
Names	Dentin Matrix Acidic Phosphoprotein 1, DMP-1, Dentin Matrix Protein 1, DMP1
Accession #	Q13316
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDSTQSEEGLGSDDH QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQA SEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSELD DEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEE DDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESS QEANLSSQENSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADS ESSESLNFSEESPESPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTES KSSSEEDGQLKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGYVDHHHHHH
Background	Dentin Matrix Acidic Phosphoprotein 1 (DMP-1) is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. DMP-1 is expressed in teeth particularly in odontoblast, ameloblast, and cementoblast. DMP-1 is critical for proper mineralization of bone and dentin. DMP-1 may have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, the unphosphorylated form of DMP-1 acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase, DMP-1 is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite. DMP-1 mutations have also been shown to cause rickets hypophosphatemic autosomal recessive type 1 (ARHR1).