Recombinant Human Dentin Matrix Acidic Phosphoprotein 1/DMP-1
| Product name: | Recombinant Human Dentin Matrix Acidic Phosphoprotein 1/DMP-1 |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Human Dentin matrix protein 1 is produced by our Mammalian expression system and the target gene encoding Lys17-Tyr513 is expressed with a 6His tag at the C-terminus. |
| Names | Dentin Matrix Acidic Phosphoprotein 1, DMP-1, Dentin Matrix Protein 1, DMP1 |
| Accession # | Q13316 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
LPVTRYQNNESEDSEEWKGHLAQAPTPPLESSESSEGSKVSSEEQANEDPSDSTQSEEGLGSDDH QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQA SEESAPQGQDSAQDTTSESRELDNEDRVDSKPEGGDSTQESESEEHWVGGGSDGESSHGDGSELD DEGMQSDDPESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEE DDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEESQNVDGPSSESS QEANLSSQENSSESQEEVVSESRGDNPDPTTSYVEDQEDSDSSEEDSSHTLSHSKSESREEQADS ESSESLNFSEESPESPEDENSSSQEGLQSHSSSAESQSEESHSEEDDSDSQDSSRSKEDSNSTES KSSSEEDGQLKNIEIESRKLTVDAYHNKPIGDQDDNDCQDGYVDHHHHHH
|
| Background | Dentin Matrix Acidic Phosphoprotein 1 (DMP-1) is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. DMP-1 is expressed in teeth particularly in odontoblast, ameloblast, and cementoblast. DMP-1 is critical for proper mineralization of bone and dentin. DMP-1 may have a dual function during osteoblast differentiation. In the nucleus of undifferentiated osteoblasts, the unphosphorylated form of DMP-1 acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the osteoblast to osteocyte transition phase, DMP-1 is phosphorylated and exported into the extracellular matrix, where it regulates nucleation of hydroxyapatite. DMP-1 mutations have also been shown to cause rickets hypophosphatemic autosomal recessive type 1 (ARHR1). |












