Recombinant Human GPD1/GDP-C

Instruction Manual!

Product name:	Recombinant Human GPD1/GDP-C
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human GPD1 is produced by our Mammalian expression system and the target gene encoding Met1-Met349 is expressed with a 6His tag at the C-terminus.
Names	Glycerol-3-Phosphate Dehydrogenase [NAD(+)] Cytoplasmic, GPD-C, GPDH-C, GPD1
Accession #	P21695
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLP GHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLK LISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVD TVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVAD LITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAV YKVCYEGQPVGEFIHCLQNHPEHMVDHHHHHH
Background	Glycerol-3-Phosphate Dehydrogenase [NAD(+)], Cytoplasmic (GPDH-C) belongs to the NAD-Dependent Glycerol-3-Phosphate Dehydrogenase family. GPDH-C plays a critical role in carbohydrate and lipid metabolism by catalyzing the reversible conversion of Dihydroxyacetone Phosphate (DHAP) and reducing Nicotine Adenine Dinucleotide (NADH) to Glycerol-3-Phosphate (G3P) and NAD+. GPDH-C is inhibited by zinc ions and sulfate. Mutations in this gene are a cause of transient infantile hypertriglyceridemia. GPDH-C is unlike Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH); they have different substrates.