Recombinant Human MAP3K12-Binding Inhibitory Protein 1/MBIPP

Instruction Manual!

Product name:	Recombinant Human MAP3K12-Binding Inhibitory Protein 1/MBIPP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human MAP3K12-Binding Inhibitory Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Pro344 is expressed with a 6His tag at the N-terminus.
Names	MAP3K12-Binding Inhibitory Protein 1, MAPK Upstream Kinase-Binding Inhibitory Protein, MUK-Binding Inhibitory Protein, MBIP
Accession #	Q9NS73
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMAAATEHNRPSSGDRNLERRCSPNLSREVLYEIFRSLHTLVGQLD LRDDVVKITIDWNKLQSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMG NKNEVNDKFSIGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEIN ENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVYTYGPQTRPEGIPGSGHKPNSML RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKV QPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLPLEHHHHHH
Background	MAP3K12-binding inhibitory protein 1 (MBIP) is a 39kD protein high expression in the heart and lung. It is a component of the ADA2A-containing complex (ATAC) complex, a complex with histone acetyltransferase activity on histones H3 and H4, and composed of CSRP2BP, KAT2A, TADA2L, TADA3L, ZZ3, MBIP, WDR5, YEATS2, CCDC101 and DR1. In the complex, it probably interacts directly with KAT2A, CSRP2BP and WDR5. It’s function to inhibit the MAP3K12 activity to induce the activation of the JNK/SAPK pathway.