Recombinant Human Golgi Membrane Protein 1/GOLM1

Instruction Manual!

Product name:	Recombinant Human Golgi Membrane Protein 1/GOLM1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Golgi Membrane Protein 1/ is produced by our Mammalian expression system and the target gene encoding Ser35-Leu400 is expressed with a 6His tag at the C-terminus.
Names	Golgi Membrane Protein 1, Golgi Membrane Protein GP73, Golgi Phosphoprotein 2, GOLM1, C9orf155, GOLPH2
Accession #	Q8NBJ4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQ DEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKE VKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGN SKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGE LGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLVDHHHHHH
Background	Golgi Membrane Protein 1 (GOLM1) belongs to the GOLM1/CASC4 family, GOLM1 is a single-pass type II membrane protein and can be found in many tissues . GOLM1 is overexpressed in prostate cancer and lung adenocarcinoma tissue. GOLM1 can be up-regulated in response to viral infection. GOLM1 is induced by the E1A adenoviral protein. GOLM1 plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum.