Recombinant Human SRSF Protein Kinase 2/SRPK2/SFRSK2

Instruction Manual!

Product name:	Recombinant Human SRSF Protein Kinase 2/SRPK2/SFRSK2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human SRSF Protein Kinase 2 is produced by our Mammalian expression system and the target gene encoding Met1-Ser688 is expressed with a 6His tag at the C-terminus.
Names	SRSF Protein Kinase 2, SFRS Protein Kinase 2, Serine/Arginine-Rich Protein-Specific Kinase 2, SR-Protein-Specific Kinase 2, SRPK2
Accession #	P78362
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCK GGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLK CVRESDRSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIR QVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKP IGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKL KTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENG PFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFST SLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRN ADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFE PHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWGLFDVLVEKYG WPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNSVDHHHHHH
Background	SRSF Protein Kinase 2 (SRPK2) belongs to the protein kinase superfamily and CMGC Ser/Thr protein kinase family. Serine/arginine-rich protein-specific kinase that specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing factors and the regulation of splicing. SFRSK2 can be cleaved into SRSF protein kinase 2 N-terminal and SRSF protein kinase 2 C-terminal chains and contains one protein kinase domain. SFRSK2 can mediate hepatitis B virus (HBV) core protein phosphorylation. SFRSK2 plays a negative role in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein.