Recombinant Human Ubiquitin-Conjugating Enzyme E2 B/UBE2B/HR6B

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 B/UBE2B/HR6B
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 B is produced by our Mammalian expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 B, RAD6 Homolog B, HR6B, hHR6B, Ubiquitin Carrier Protein B, Ubiquitin-Conjugating Enzyme E2-17 kDa, Ubiquitin-Protein Ligase B, UBE2B, RAD6B
Accession #	P63146
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPN KPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLY QENKREYEKRVSAIVEQSWNDSLDHHHHHH
Background	Ubiquitin-Conjugating Enzyme E2 B (UBE2B) is a member of the ubiquitin-conjugating enzyme family. UBE2B accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. It is shown that UBE2B interacts with RAD18, UBR2, and WAC. UBE2B is required for post-replicative DNA damage repair. Additional, UBE2B plays a role in sepsis-induced muscle protein proteolysis and cancer-induced cachexia.