elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Trefoil Factor 2/TFF2

Recombinant Human Trefoil Factor 2/TFF2 Recombinant Human Trefoil Factor 2/TFF2

Instruction Manual!

Product name: Recombinant Human Trefoil Factor 2/TFF2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus.
Names Trefoil Factor 2, Spasmolysin, Spasmolytic Polypeptide, SP, TFF2, SML1
Accession # Q03403
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDR RNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH
Background Trefoil Factor 2 (TFF2) is a member of the trefoil family and contains two P-type (trefoil) domains. Members of this family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF2 is a secreted protein and specifically expressed in the stomach. TFF2 inhibits gastrointestinal motility and gastric acid secretion. TFF2 could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese