Recombinant Human Myelin-Associated Glycoprotein/MAG/Siglec-4a

Instruction Manual!

Product name:	Recombinant Human Myelin-Associated Glycoprotein/MAG/Siglec-4a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Myelin Associated Glycoprotein is produced by our Mammalian expression system and the target gene encoding Gly20-Pro516 is expressed with a 6His tag at the C-terminus.
Names	Myelin-Associated Glycoprotein, Siglec-4a, MAG, GMA
Accession #	P20916
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHES FQGRSRLLGDLGLRNCTLLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEV VAGTEVEVSCMVPDNCPELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREANGHR LGCQASFPNTTLQFEGYASMDVKYPPVIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGTV LREAVAESLLLELEEVTPAEDGVYACLAENAYGQDNRTVGLSVMYAPWKPTVNGTMVAVEGETVS ILCSTQSNPDPILTIFKEKQILSTVIYESELQLELPAVSPEDDGEYWCVAENQYGQRATAFNLSV EFAPVLLLESHCAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESEREFVYSERSGLVLTSIL TLRGQAQAPPRVICTARNLYGAKSLELPFQGAHRLMWAKIGPVDHHHHHH
Background	Human Myelin-Associated Glycoprotein,also known as MAG, Siglec-4,is a cell membrane glycoprotein that is a member of the SIGLEC family of proteins.MAG contains 4 Ig-like C2-type domains and 1 Ig-like V-type domain.MAG is believed to be involved in myelination during nerve regeneration. it is a adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells and Preferentially binds to alpha-2,3-linked sialic acid.