Recombinant Human Sulfotransferase 2B1/SULT2B1

Instruction Manual!

Product name:	Recombinant Human Sulfotransferase 2B1/SULT2B1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM EDTA, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Sulfotransferase 2B1 is produced by our E.coli expression system and the target gene encoding Met1-Glu311 is expressed with a 6His tag at the C-terminus.
Names	Sulfotransferase Family Cytosolic 2B Member 1, ST2B1, Sulfotransferase 2B1, Alcohol Sulfotransferase, Hydroxysteroid Sulfotransferase 2, SULT2B1, HSST2
Accession #	O00204
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM EDTA, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI ITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQI FTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKG WLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLL PPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEVDHHHHHH
Background	Sulfotransferase Family Cytosolic 2B Member 1(SULT2B1) is a member of the Sulfotransferase 1 family. SULT2B1 is highly expressed in the placenta, prostate, and trachea with lower expression levels in the small intestine and lung. SULT2B1 catalyzes the sulfate conjugation of numerous hormones, neurotransmitters, drugs, and xenobiotic compounds. Sulfonation enhances the water solubility of molecules, and therefore their renal excretion, however SULT2B1 can also result in bioactivation to form active metabolites.