elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Protein-Arginine Deiminase Type-4/PADI4

Recombinant Human Protein-Arginine Deiminase Type-4/PADI4 Recombinant Human Protein-Arginine Deiminase Type-4/PADI4

Instruction Manual!

Product name: Recombinant Human Protein-Arginine Deiminase Type-4/PADI4
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 50mM Tris, 500mM NaCl, pH 7.5.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human PADI4/ is produced by our E.coli expression system and the target gene encoding Met1-Pro663 is expressed with a 6His tag at the N-terminus.
Names Protein-Arginine Deiminase Type-4, HL-60 PAD, Peptidylarginine Deiminase IV, Protein-arginine Deiminase type IV, PADI4, PADI5, PDI5
Accession # Q9UM07
Formulation Supplied as a 0.2 μm filtered solution of 50mM Tris, 500mM NaCl, pH 7.5.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINAS PGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL TAVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSE DLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTPNTQPP QEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDS PRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCY PSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKL FQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLAESDII DIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFI NDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP
Background Protein-Arginine Deiminase Type-4 (PADI4) belongs to the Protein Arginine Deiminase family. PADI4 is expressed in eosinophils and neutrophils, but it is not expressed in peripheral monocytes or lymphocytes. PADI4 catalyzes the citrullination/deimination of arginine residues of proteins. In addition, PADI4 may play an important role in tumourigenesis. Genetic variations in PADI4 are a cause of susceptibility to rheumatoid arthritis (RA), which is a systemic inflammatory disease with autoimmune features and a complex genetic component.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese