Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1

Instruction Manual!

Product name:	Recombinant Human D-β-Hydroxybutyrate Dehydrogenase Mitochondrial/BDH1
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM Tris, 1mM DTT, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human 3-Hydroxybutyrate Dehydrogenase is produced by our E.coli expression system and the target gene encoding Met1-Arg343 is expressed with a 6His tag at the N-terminus.
Names	D-Beta-Hydroxybutyrate Dehydrogenase Mitochondrial, BDH, 3-Hydroxybutyrate Dehydrogenase, BDH
Accession #	Q02338
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris, 1mM DTT, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRT YASAAEPVGSKAVLVTGCDSGFGFALAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTV QLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRM TKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGN FIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHA LTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR
Background	D-Beta-Hydroxybutyrate Dehydrogenase Mitochondrial (BDH) is a member of the short-chain dehydrogenases/reductases (SDR) family. BDH is localized in the mitochondrion matrix. BDH forms a homotetrameric lipid-requiring enzyme of the mitochondrial membrane and has a specific necessity for phosphatidylcholine for optimal enzymatic activity. BDH catalyzes the interconversion of acetoacetate and (R)-3-hydroxybutyrate, the 2 main ketone bodies formed during fatty acid catabolism.