Recombinant Human B-Cell Differentiation Antigen CD72/Lyb‑2
Product name: | Recombinant Human B-Cell Differentiation Antigen CD72/Lyb‑2 |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human CD72 is produced by our E.coli expression system and the target gene encoding Arg117-Cys226 is expressed with a Trx, 6His tag at the N-terminus. |
Names | B-Cell Differentiation Antigen CD72, Lyb-2, CD72 |
Accession # | P21854 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMRYLQVSQQLQQTNRVLEVTNSSLRQQLRL KITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALE QKLSNMENRLKPFFTC
|
Background | B-Cell Differentiation Antigen CD72 (CD72) is a single-pass type II membrane protein. CD72 exists as a disulfide-linked homodimer and contains one C-type lectin domain. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 is a ligand for CD5. CD72 associates with CD5, interacts with PTPN6/SHP-1 and plays a role in B-cell proliferation and differentiation. CD72 associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP-1. |