Recombinant Human GALNTL1

Instruction Manual!

Product name:	Recombinant Human GALNTL1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human GALNTL1 is produced by our Mammalian expression system and the target gene encoding Asp27-Thr558 is expressed with a 6His tag at the C-terminus.
Names	Putative Polypeptide N-Acetylgalactosaminyltransferase-Like Protein 1, Polypeptide GalNAc Transferase-Like Protein 1, GalNAc-T-Like Protein 1, pp-GaNTase-Like Protein 1, Protein-UDP Acetylgalactosaminyltransferase-Like Protein 1, UDP-GalNAc:Polypeptide N-Acetylgalactosaminyltransferase-Like Protein 1, GALNTL1, KIAA1130
Accession #	Q8N428
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DNRAHAASSGGRGAQRAGRRSEQLREDRTIPLIVTGTPSKGFDEKAYLSAKQLKAGEDPYRQHAF NQLESDKLSPDRPIRDTRHYSCPSVSYSSDLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIQ EIILVDDFSSDPEDCLLLTRIPKVKCLRNDRREGLIRSRVRGADVAAATVLTFLDSHCEVNTEWL PPMLQRVKEDHTRVVSPIIDVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTRP IRTPVIAGGIFVIDKSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRH PYNFPEGNALTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYL ENVYPELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLIQ QQGKCLAATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQAD AQAQQWQLLPHTVDHHHHHH
Background	Putative polypeptide N-acetylgalactosaminyltransferase-like protein 1, also known as Polypeptide GalNAc transferase-like protein 1, Protein-UDP acetylgalactosaminyltransferase-like protein 1, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 1, GalNAC-T-like protein 1, pp-GaNTase-like protein 1 and GALNTL1, belongs to the glycosyltransferase 2 family. GALNTL1 plays an important role in the protein modification and protein glycosylation process. GALNTL1 uses the manganese and calcium ion as a cofactor, may catalyze the initial reaction in O-linked oligosaccharide biosynthesis, transfers the N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.