Recombinant Human High Mobility Group Protein B3/HMGB3

Instruction Manual!

Product name:	Recombinant Human High Mobility Group Protein B3/HMGB3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human High Mobility Group Protein B3 is produced by our Mammalian expression system and the target gene encoding Met1-Glu200 is expressed with a 6His tag at the C-terminus.
Names	High Mobility Group Protein B3, High Mobility Group Protein 2a, HMG-2a, High Mobility Group Protein 4, HMG-4, HMGB3, HMG2A, HMG4
Accession #	O15347
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAK ADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEM WNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEE EEEDEVDHHHHHH
Background	High Mobility Group Protein B3 (HMGB3) belongs to the HMGB family. Members of the HMG box subfamily are thought to be have an important role in DNA replication, nucleosome assembly and transcription. HMGB3 binds preferentiallly single-stranded DNA and unwinds double stranded DNA. HMGB3 consists of 200 amino acids and is localized to the cell nucleus. It contains two HMG box DNA-binding domain. HMGB3 binds preferentially single-stranded DNA and unwinds double stranded DNA.