Recombinant Human Cocaine- and Amphetamine-Regulated Transcript/CARTPT

Instruction Manual!

Product name:	Recombinant Human Cocaine- and Amphetamine-Regulated Transcript/CARTPT
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CARTPT is produced by our Mammalian expression system and the target gene encoding Gln28-Leu116 is expressed with a 6His tag at the C-terminus.
Names	Cocaine- and Amphetamine-Regulated Transcript Protein, CARTPT, CART
Accession #	Q16568
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRK GARIGKLCDCPRGTSCNSFLLKCLVDHHHHHH
Background	Cocaine- and Amphetamine-Regulated Transcript Protein (CARTPT) is a secreted protein that belongs to the CART family. CARTPT is detected in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus. CARTPT is processed by prohormone/proprotein convertases to produce smaller, biologically active peptides. CARTPT is a satiety factor closely associated with the actions of leptin and neuropeptide Y. This anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. CARTPT promotes neuronal development and survival in vitro.