Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317

Instruction Manual!

Product name:	Recombinant Human Bone Marrow Stromal Antigen 2/BST2/Tetherin/CD317
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus.
Names	Bone Marrow Stromal Antigen 2, BST-2, HM1.24 Antigen, Tetherin, CD317, BST2
Accession #	Q10589
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKV EELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH
Background	Bone Marrow Stromal Antigen 2 (BST2) is a single-pass type II membrane protein that belongs to the tetherin family. BST2 is predominantly expressed in the liver, lung, heart and placenta. BST2 is involved in the sorting of secreted proteins. BST2 is a human cellular protein which inhibits retrovirus infection by preventing the diffusion of virus particles after budding from infected cells. BST2 is initially discovered as an inhibitor to HIV-1 infection in the absence of Vpu, it has also been shown to inhibit the release of other viruses such as retroviruses, filoviruses, arenaviruses, and herpes viruses. BST2 may play a role in B-cell activation in rheumatoid arthritis.