Recombinant Human VIP36/LMAN2/GP36b

Instruction Manual!

Product name:	Recombinant Human VIP36/LMAN2/GP36b
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl,10mM GSH,pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus.
Names	Vesicular Integral-Membrane Protein VIP36, Glycoprotein GP36b, Lectin Mannose-Binding 2, Vesicular Integral-Membrane Protein 36, VIP36, LMAN2, C5orf8
Accession #	Q12907
Formulation	Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl,10mM GSH,pH8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFL KDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVF PYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNC IDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKD NVDDPTGNFRSGPLTGWRVDHHHHHH
Background	Vesicular integral-membrane protein VIP36 is also known as Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36, LMAN2 and C5orf8. LMAN2 is widely expressed and contains one L-type lectin-like domain. LMAN2 binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. LMAN2 plays a role as an intracellular lectin in the early secretory pathway. LMAN2 interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. LMAN2 is also involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.