Recombinant Human Aldehyde Dehydrogenase 1-A1/ALDH1A1
Product name: | Recombinant Human Aldehyde Dehydrogenase 1-A1/ALDH1A1 |
Source: | E. coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,pH8.5. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Human Aldehyde Dehydrogenase 1-A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser501 is expressed with a 6His tag at the N-terminus. |
Names | Retinal Dehydrogenase 1, RALDH 1, RalDH1, ALDH-E1, ALHDII, Aldehyde Dehydrogenase Family 1 Member A1, Aldehyde Dehydrogenase Cytosolic, ALDH1A1, ALDC, ALDH1, PUMB1 |
Accession # | P00352 |
Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,pH8.5. |
Shipping |
The product is shipped on dry ice/ice packs. |
Storage |
Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPAT EEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN GGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVM LIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIA ASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLEC GGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTK DIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKN S
|
Background | Aldehyde Dehydrogenase Family 1 Member A1 (ALDH1A1) is a cytoplasmic enzyme that belongs to the Aldehyde Dehydrogenase family. ALDH1A1 is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties and subcellular localizations. ALDH1A1 is the main cytosolic isoform, which has a lower affinity for aldehydes than the mitochondrial enzyme. ALDH1A1 binds free retinal and cellular retinol-binding protein-bound retinal. It can convert/oxidize retinaldehyde to retinoic acid. |