Recombinant Human PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3

Instruction Manual!

Product name:	Recombinant Human PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human PHLDA2 is produced by our E.coli expression system and the target gene encoding Met1-Pro152 is expressed with a 6His tag at the C-terminus.
Names	Pleckstrin Homology-Like Domain Family A Member 2, Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein, Imprinted in Placenta and Liver Protein, Tumor-Suppressing STF cDNA 3 Protein, Tumor-Suppressing Subchromosomal Transferable Fragment Candidate Gene 3 Protein, p17-Beckwith-Wiedemann Region 1 C, p17-BWR1C, PHLDA2, BWR1C, HLDA2, IPL, TSSC3
Accession #	Q53GA4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTG KYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAA AAAPSEPSEPSRPSPQPKPRTPLEHHHHHH
Background	Pleckstrin Homology-Like Domain Family A Member 2 (PHLDA2) is a peripheral membrane protein that belongs to the PHLDA2 family. PHLDA2 is expressed in the placenta and adult prostate gland. In the placenta, it is present in all cells of the villous cytotrophoblast. PHLDA2 plays a role in regulating placenta growth. PHLDA2 may act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids.