Recombinant Human PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3
| Product name: | Recombinant Human PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3 |
| Source: | E. coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E. coli |
| Description | Recombinant Human PHLDA2 is produced by our E.coli expression system and the target gene encoding Met1-Pro152 is expressed with a 6His tag at the C-terminus. |
| Names | Pleckstrin Homology-Like Domain Family A Member 2, Beckwith-Wiedemann Syndrome Chromosomal Region 1 Candidate Gene C Protein, Imprinted in Placenta and Liver Protein, Tumor-Suppressing STF cDNA 3 Protein, Tumor-Suppressing Subchromosomal Transferable Fragment Candidate Gene 3 Protein, p17-Beckwith-Wiedemann Region 1 C, p17-BWR1C, PHLDA2, BWR1C, HLDA2, IPL, TSSC3 |
| Accession # | Q53GA4 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTG KYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAA AAAPSEPSEPSRPSPQPKPRTPLEHHHHHH
|
| Background | Pleckstrin Homology-Like Domain Family A Member 2 (PHLDA2) is a peripheral membrane protein that belongs to the PHLDA2 family. PHLDA2 is expressed in the placenta and adult prostate gland. In the placenta, it is present in all cells of the villous cytotrophoblast. PHLDA2 plays a role in regulating placenta growth. PHLDA2 may act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids. |












