Recombinant Human Hematopoietic Prostaglandin D Synthase/HPGDS/GSTS

Instruction Manual!

Product name:	Recombinant Human Hematopoietic Prostaglandin D Synthase/HPGDS/GSTS
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Hematopoietic Prostaglandin D Synthase is produced by our E.coli expression system and the target gene encoding Met1-Leu199 is expressed.
Names	Hematopoietic Prostaglandin D Synthase, H-PGDS, GST Class-Sigma, Glutathione S-Transferase, Glutathione-Dependent PGD Synthase, Glutathione-Requiring Prostaglandin D Synthase, Prostaglandin-H2 D-Isomerase, HPGDS, GSTS, PGDS, PTGDS2
Accession #	O60760
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 200mM NaCl, pH 7.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSL AIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQD LDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRP QTKL
Background	Hematopoietic Prostaglandin D Synthase (HPGDS) belongs to the GST superfamily and Sigma family. HPGDS contains one GST C-terminal domain and one GST N-terminal domain. HPGDS is highly expressed in adipose tissue, macrophages, and placenta, and it exists in the form of homodimer in living body. HPGDS is a cytosolic enzyme that isomerizes PGH(2). HPGDS is a bifunctional enzyme that catalyzes both the conversion of PGH2 to PGD2 and also shows low glutathione-peroxidase activity towards cumenehydroperoxide.