Recombinant Human Ubiquitin-Conjugating Enzyme E2 B/UBE2B/HR6B

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 B/UBE2B/HR6B
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 10mM HEPES, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 B is produced by our E.coli expression system and the target gene encoding Met1-Ser152 is expressed.
Names	Ubiquitin-Conjugating Enzyme E2 B, RAD6 Homolog B, HR6B, hHR6B, Ubiquitin Carrier Protein B, Ubiquitin-Conjugating Enzyme E2-17 kDa, Ubiquitin-Protein Ligase B, UBE2B, RAD6B
Accession #	P63146
Formulation	Supplied as a 0.2 μm filtered solution of 10mM HEPES, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GSHMSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEE YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAA QLYQENKREYEKRVSAIVEQSWNDS
Background	Ubiquitin-Conjugating Enzyme E2 B (UBE2B) belongs to the ubiquitin-conjugating enzyme family. UBE2B can catalyze the covalent attachment of ubiquitin to other proteins, and is essential for the multi-ubiquitination and degradation of N-end rule substrates. UBE2B is indispensability for postreplication repair of UV-damaged DNA and may be involved in neurite outgrowth.Additionally, UBE2B may have a role in sepsis-induced muscle protein proteolysis and cancer-induced cachexia.