Recombinant Human PDCD4/H731

Instruction Manual!

Product name:	Recombinant Human PDCD4/H731
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Programmed Cell Death Protein 4 is produced by our E.coli expression system and the target gene encoding Lys212-Pro357 is expressed with a 6His tag at the C-terminus.
Names	Programmed Cell Death Protein 4, Neoplastic Transformation Inhibitor Protein, Nuclear Antigen H731-Like, Protein 197/15a, PDCD4, H731
Accession #	Q53EL6
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILC NTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLL SGDISEAEHCLKELEVPLEHHHHHH
Background	Programmed Cell Death Protein 4 (PDCD4) is a member of the PDCD4 family. PDCD4 and EIF4A1 form a heterotrimer. One molecule of PDCD4 binds two molecules of EIF4A1. PDCD4 takes part in apoptosis via inhibiting translation initiation and cap-dependent translation.PDCD4 promotes colonic neoplastic transformation and tumor invasion. PDCD4 is an important target for microrna R-21 in breast cancer cells. Shortage of PDCD4 expression is associated with colorectal cancer. Overexpression of PDCD4 in carcinoid cells results in inhibition of cell proliferation.