Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10

Instruction Manual!

Product name:	Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His, T7 tag at the N-terminus.
Names	Ubiquitin-Conjugating Enzyme E2 C, UbcH10, Ubiquitin Carrier Protein C, Ubiquitin-Protein Ligase C, UBE2C, UBCH10
Accession #	O00762
Formulation	Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSHMASQNRDPAATSVAAARKGAEPSGGAARGP VGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPT VKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPT AFKKYLQETYSKQVTSQEP
Background	Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a member of the ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. UBE2C acts as an essential factor of the anaphase, promotes complex/cyclosome (APC/C) controls progression through mitosis.