Recombinant Human Protein Arginine N-Methyltransferase 1/PRMT1/HMT2

Instruction Manual!

Product name:	Recombinant Human Protein Arginine N-Methyltransferase 1/PRMT1/HMT2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl，pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human Protein Arginine N-Methyltransferase 1 is produced by our E.coli expression system and the target gene encoding Met1-Arg343 is expressed with a 6His tag at the N-terminus.
Names	Protein arginine N-Methyltransferase 1, Histone-arginine N-Methyltransferase PRMT1, Interferon Receptor 1-Bound Protein 4, PRMT1, HMT2, HRMT1L2, IR1B4
Accession #	Q99873-3
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl，pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRT LTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHV VTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAI EDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFT SPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFG TIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
Background	Protein Arginine N-Methyltransferase 1 (PRMT1) is a cytoplasmic protein that belongs to the protein arginine N-methyltransferase family. PRMT1 is a arginine methyltransferase that functions as a histone methyltransferase for H4. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes. PRMT1 methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. PRMT1 is responsible for the majority of cellular arginine methylation activity. Together with dimethylated PIAS1, it represses STAT1 transcriptional activity in the late phase of interferon gamma (IFN-gamma) signaling. It may be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and serve as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway.