Recombinant Human DNA Polymerase δ Subunit 2/POLD2

Instruction Manual!

Product name:	Recombinant Human DNA Polymerase δ Subunit 2/POLD2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human DNA Polymerase Delta Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Pro469 is expressed with a 6His tag at the C-terminus.
Names	DNA Polymerase Delta Subunit 2, DNA Polymerase Delta Subunit p50, POLD2
Accession #	P49005
Formulation	Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFL ENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPD DELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRF VLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINK AKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTL QLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKT DPFIFPECPHVYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGF GAEDDDLGGLGLGPLEHHHHHH
Background	DNA Polymerase Delta Subunit 2 (POLD2) belongs to the DNA polymerase delta/II small subunit family. POLD2 can form a heterotetramer composed of subunits of 125 kDa, 50 kDa, 66 kDa and 12 kDa. POLD2 possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. POLD2 is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA).