Recombinant Human B3GNT1

Instruction Manual!

Product name:	Recombinant Human B3GNT1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human B3GNT1 is produced by our Mammalian expression system and the target gene encoding Asp43-Cys415 is expressed with a 6His tag at the C-terminus.
Names	N-Acetyllactosaminide Beta-1,3-N-Acetylglucosaminyltransferase, I-Beta-1,3-N-Acetylglucosaminyltransferase, iGnT, Poly-N-Acetyllactosamine Extension Enzyme, UDP-GlcNAc:BetaGal Beta-1,3-N-Acetylglucosaminyltransferase 1, B3GNT1, B3GNT6
Accession #	O43505
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DQYFEFFPPSPRSVDQVKAQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLL HLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPDPRE PGEFALLRSCQEVFDKLARVAQPGINYALGTNVSYPNNLLRNLAREGANYALVIDVDMVPSEGLW RGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTNYS RWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLN EGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRCVDHHHHHH
Background	N-Acetyllactosaminide β-1,3-N-Acetylglucosaminyltransferase (B3GNT1) is a member of the β-1,3-N-Acetylglucosaminyltransferase family. B3GNT1 is a single-pass type II membrane protein and widely expressed in many tissues. B3GNT1 can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans. B3GNT1 is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. It can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans.