Recombinant Human B3GNT1
Product name: | Recombinant Human B3GNT1 |
Source: | Human Cells |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human B3GNT1 is produced by our Mammalian expression system and the target gene encoding Asp43-Cys415 is expressed with a 6His tag at the C-terminus. |
Names | N-Acetyllactosaminide Beta-1,3-N-Acetylglucosaminyltransferase, I-Beta-1,3-N-Acetylglucosaminyltransferase, iGnT, Poly-N-Acetyllactosamine Extension Enzyme, UDP-GlcNAc:BetaGal Beta-1,3-N-Acetylglucosaminyltransferase 1, B3GNT1, B3GNT6 |
Accession # | O43505 |
Formulation | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
DQYFEFFPPSPRSVDQVKAQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLL HLSGLLERWEGPLSVSVFAATKEEAQLATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPDPRE PGEFALLRSCQEVFDKLARVAQPGINYALGTNVSYPNNLLRNLAREGANYALVIDVDMVPSEGLW RGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTNYS RWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLN EGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRCVDHHHHHH
|
Background | N-Acetyllactosaminide β-1,3-N-Acetylglucosaminyltransferase (B3GNT1) is a member of the β-1,3-N-Acetylglucosaminyltransferase family. B3GNT1 is a single-pass type II membrane protein and widely expressed in many tissues. B3GNT1 can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans. B3GNT1 is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. It can initiate the synthesis or the elongation of the linear poly-N-acetyllactosaminoglycans. |