Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3/FLRT3

Instruction Manual!

Product name:	Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3/FLRT3
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human FLRT3 is produced by our Mammalian expression system and the target gene encoding Lys29-Pro528 is expressed with a 6His tag at the C-terminus.
Names	Leucine-Rich Repeat Transmembrane Protein FLRT3, Fibronectin-Like Domain-Containing Leucine-Rich Transmembrane Protein 3, FLRT3, KIAA1469
Accession #	Q9NZU0
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHN SLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRL LFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFN LVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELF DCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSV TSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMVPME TSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPVDHHHHHH
Background	Leucine-Rich Repeat Transmembrane Protein FLRT3 (FLRT3) is a member of the fibronectin leucine rich transmembrane protein (FLRT) family. Proteins in this family play an role in cell adhesion and/or receptor signalling. FLRT3 is a single-pass type I membrane protein and contains one fibronectin type-III domain, ten LRR (leucine-rich) repeats, one LRRCT domain, and one LRRNT domain. FLRT3 may have a function in cell adhesion and/or receptor signaling. FLRT3 may regulate cellular adhesion between the epithelial apical ridge and the underlying mesenchyme and in establishing the dorso-ventral position of the ridge.