Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α/MAP1LC3A

Instruction Manual!

Product name:	Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α/MAP1LC3A
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human MAP1LC3A is produced by our E.coli expression system and the target gene encoding Met1-Phe121 is expressed with a 6His tag at the C-terminus.
Names	Microtubule-Associated Proteins 1A/1B Light Chain 3A, Autophagy-Related Protein LC3 A, Autophagy-Related Ubiquitin-Like Modifier LC3 A, MAP1 Light Chain 3-Like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-Associated Protein 1 Light Chain 3 Alpha, MAP1LC3A
Accession #	Q9H492
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVK IIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
Background	Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity.