elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Galectin-Related Protein/LGALSL

Recombinant Human Galectin-Related Protein/LGALSL Recombinant Human Galectin-Related Protein/LGALSL

Instruction Manual!

Product name: Recombinant Human Galectin-Related Protein/LGALSL
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Galectin-Related Protein is produced by our E.coli expression system and the target gene encoding Ala2-Ser172 is expressed with a 6His tag at the C-terminus.
Names Galectin-Related Protein, Lectin Galactoside-Binding-Like Protein, LGALSL, GRP, HSPC159
Accession # Q3ZCW2
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPES FAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCE HPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
Background Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese