Recombinant Human α-Parvin/PARVA/MXRA2

Instruction Manual!

Product name:	Recombinant Human α-Parvin/PARVA/MXRA2
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM Tris, 150mM NaCl, 40% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human alpha-Parvin is produced by our E.coli expression system and the target gene encoding Met1-Glu372 is expressed with a 6His tag at the C-terminus.
Names	Alpha-Parvin, Actopaxin, CH-ILKBP, Calponin-Like Integrin-Linked Kinase-Binding Protein, Matrix-Remodeling-Associated Protein 2, PARVA, MXRA2
Accession #	Q9NVD7
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris, 150mM NaCl, 40% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MATSPQKSPSAPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIP FELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQ KLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLV ALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDK LNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVL NVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVELEHHHHHH
Background	Alpha-Parvin (PARVA) is a member of the Parvin family. PARVA contains two CH (calponin-homology) domains. PARVA is widely expressed, with highest levels in heart, skeletal muscle, kidney and liver. PARVA interacts with integrin-linked protein kinase and probably with actin and the LD1 and LD4 motifs of PXN. PARVA may play a role in the regulation of cell adhesion and cytoskeleton organization. PARVA is also involved in ciliogenesis.