Recombinant Human DNA Fragmentation Factor Subunit α/DFFA/DFF45/ICAD

Instruction Manual!

Product name:	Recombinant Human DNA Fragmentation Factor Subunit α/DFFA/DFF45/ICAD
Source:	E. coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Human DFF45 is produced by our E.coli expression system and the target gene encoding Met1-Thr331 is expressed with a 6His tag at the N-terminus.
Names	DNA Fragmentation Factor Subunit Alpha, DNA Fragmentation Factor 45 kDa Subunit, DFF-45, Inhibitor of CAD, ICAD, DFFA, DFF1, DFF45, H13
Accession #	O00273
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSK ACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQES FDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTL QQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASH ILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHS LRSISASKASPPGDLQNPKRARQDPT
Background	DNA Fragmentation Factor Subunit Alpha (DFFA). DFFA exists as a heterodimer (DFF) with DFFB. DFF is activated once DFFA is cleaved by Caspase-3. The cleaved fragments of DFFA detach from DFFB (the active component of DFF), which in turn triggers DNA fragmentation as well as chromatin condensation during apoptosis. A reduced level of DFFA detected in ovarian endometriosis may be a part of an apoptosis-resistant mechanism enhancing the disease progression.