Recombinant Human NHP2-Like Protein 1/NHP2L1

Instruction Manual!

Product name:	Recombinant Human NHP2-Like Protein 1/NHP2L1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 600mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human NHP2L1 is produced by our E.coli expression system and the target gene encoding Met1-Val128 is expressed with a 6His tag at the N-terminus.
Names	NHP2-Like Protein 1, High Mobility Group-Like Nuclear Protein 2 Homolog 1, OTK27, SNU13 Homolog, hSNU13, U4/U6.U5 tri-snRNP 15.5 kDa Protein, NHP2L1
Accession #	P55769
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 600mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKT LNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGS QLKQQIQSIQQSIERLLV
Background	NHP2-Like Protein 1 (NHP2L1) is a member of the ribosomal protein L7Ae family. NHP2L1 proteinis limited to the nucleus, primarily focused in the dense fibrillar component of the nucleolus. NHP2L1 has been shown to interact with RAD17and PRPF31. The protein undergoes a conformational change upon RNA-binding. NHP2L1 binds to the 5-stem-loop of U4 snRNA and may play a role in the late stage of spliceosome assembly, prior to step I of splicing catalysis.