Recombinant Human Nucleoside Diphosphate Kinase A/NDPKA

Instruction Manual!

Product name:	Recombinant Human Nucleoside Diphosphate Kinase A/NDPKA
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Nucleoside Diphosphate Kinase A is produced by our E.coli expression system and the target gene encoding Met1-Glu152 is expressed with a 6His tag at the N-terminus.
Names	Nucleoside Diphosphate Kinase A, NDK A, NDP Kinase A, Granzyme A-Activated DNase, GAAD, Metastasis Inhibition Factor nm23, Tumor Metastatic Process-Associated Protein, nm23-H1, NME1, NDPKA, NM23
Accession #	P15531
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASE DLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCI QVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Background	Nucleoside-Diphosphate Kinases (NDKs) are enzymes that catalyze the exchange of phosphate groups between different nucleoside diphosphates. NDKs Possesse nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3-5 exonuclease activities. NDKs involved in cell proliferation, differentiation and development, signal transduction, G protein-coupled receptor endocytosis, and gene expression and required for neural development including neural patterning and cell fate determination. Prokaryotic NDK forms a functional homotetramer.There are two isoforms of NDK in humans: NDK-A and NDK-B. Both have very similar structure, and can combine in any proportion to form functional NDK hexamers.