Recombinant Human Fc Receptor-Like Protein 1/FCRL1/CD307a

Instruction Manual!

Product name:	Recombinant Human Fc Receptor-Like Protein 1/FCRL1/CD307a
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus.
Names	Fc Receptor-Like Protein 1, FcR-Like Protein 1, FcRL1, Fc Receptor Homolog 1, FcRH1, IFGP Family Protein 1, hIFGP1, Immune Receptor Translocation-Associated Protein 5, CD307a, FCRL1, FCRH1, IFGP1, IRTA5
Accession #	Q96LA6
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDT GSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFL WYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILM LRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSC EANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH
Background	Fc Receptor-Like Protein 1 (FCRL1) is a single-pass type I membrane protein that may function as an activating coreceptor in B cells. FCRL1 is primarily expressed in secondary lymphoid tissues by mature subsets of B cells. It can be detected in the spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. It is specifically expressed by mature B lineage cells with higher expression at the protein level in naive B cells compared to memory B cells. FCRL1 contains three extracellular C2-like immunoglobulin domains, a transmembrane domain, and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs and may play a role in the regulation of cancer cell growth.