Recombinant Human IL-20 Receptor Subunit α/IL20RA

Instruction Manual!

Product name:	Recombinant Human IL-20 Receptor Subunit α/IL20RA
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human IL-20 Receptor alpha is produced by our Mammalian expression system and the target gene encoding Val30-Lys250 is expressed with a 6His tag at the C-terminus.
Names	Interleukin-20 Receptor Subunit Alpha, IL-20 Receptor Subunit Alpha, IL-20R-Alpha, IL-20RA, Cytokine Receptor Class-II Member 8, Cytokine Receptor Family 2 Member 8, CRF2-8, IL-20R1, ZcytoR7, IL20RA
Accession #	Q9UHF4
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTY CDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPE KWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPG PPRRAQPSEKQCARTLKDQSSEFKAKVDHHHHHH
Background	Interleukin-20 Receptor Subunit α (IL20RA) is a single-pass type I membrane protein that is a member of the type II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29 amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24 amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed with highest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, and the complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique and specific receptor IL10RB and functions as the receptor for IL26.