Recombinant Human Leucine-Rich Repeat-Containing Protein 2/LRRN2

Instruction Manual!

Product name:	Recombinant Human Leucine-Rich Repeat-Containing Protein 2/LRRN2
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LRRTM2 is produced by our Mammalian expression system and the target gene encoding Cys34-Arg422 is expressed with a 6His tag at the C-terminus.
Names	Leucine-Rich Repeat Transmembrane Neuronal Protein 2, Leucine-Rich Repeat Neuronal 2 Protein, LRRTM2, KIAA0416, LRRN2
Accession #	O43300
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	CPPKCRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQIS TVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLH LRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRL SSLHTLFLQWNKISNLTCGMEWTWGTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLD SKILNSLRSLTTVGLSGNLWECSARICALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQ LCWNLSTTVTVMATTYRDPTTEYTKRISSSSYHVGDKEIPTTAGIAVTTEEHFPEPDNAIFTQRV DHHHHHH
Background	Leucine-Rich Repeat Transmembrane Neuronal Protein 2 (LRRTM2) is a single-pass type I membrane protein that belongs to the LRRTM family. It contains ten LRR (leucine-rich) repeats, one LRRCT domain, and one LRRNT domain. LRRTM2 is expressed in neuronal tissues, and it interacts with DLG4 and NRXN1. LRRTM2 has been suggested to be involved in the development and maintenance of excitatory synapses in the vertebrate nervous system. LRRTM2 also regulates the surface expression of AMPA receptors. LRRTM2 acts as a ligand for the presynaptic receptors NRXN1-A and NRXN1-B.