Recombinant Human LYVE-1/HAR/XLKD1

Instruction Manual!

Product name:	Recombinant Human LYVE-1/HAR/XLKD1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM Tris-Citrate,1 50mM NaCl, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human LYVE-1 is produced by our Mammalian expression system and the target gene encoding Leu20-Thr238 is expressed with a 6His tag at the C-terminus.
Names	Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, LYVE-1, Cell Surface Retention Sequence-Binding Protein 1, CRSBP-1, Extracellular Link Domain-Containing Protein 1, Hyaluronic Acid Receptor, LYVE1, CRSBP1, HAR, XLKD1
Accession #	Q9Y5Y7
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM Tris-Citrate,1 50mM NaCl, pH 7.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFET CSYGWVGDGFVVISRISPNPKCGKNGVGVLIRKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDP IFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMST ETEPFVENKAAFKNEAAGFGGVPTVDHHHHHH
Background	Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 is a single-pass type I membrane protein. LYVE-1 is a CD44 homolog found primarily on lymphatic endothelial cells 1. LYVE-1 mainly expressed in endothelial cells lining lymphatic vessels. While LYVE-1 functions is a Ligand-specific transporter trafficking between intracellular organelles (TGN) and the plasma membrane. LYVE-1 plays a role in autocrine regulation of cell growth mediated by growth regulators containing cell surface retention sequence binding (CRS). It may act as an hyaluronan (HA) transporter, either mediating its uptake for catabolism within lymphatic endothelial cells themselves, or its transport into the lumen of afferent lymphatic vessels for subsequent re-uptake and degradation in lymph nodes.