Recombinant Human PAF-AH/PLA2G7

Instruction Manual!

Product name:	Recombinant Human PAF-AH/PLA2G7
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaCl, 150mM NaCl, 10% Glycerol, pH 4.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Platelet-Activating Factor Acetylhydrolase is produced by our Mammalian expression system and the target gene encoding Phe22-Asn441 is expressed with a 6His tag at the C-terminus.
Names	Platelet-Activating Factor Acetylhydrolase, PAF Acetylhydrolase, 1-Alkyl-2-Acetylglycerophosphocholine Esterase, 2-Acetyl-1-Alkylglycerophosphocholine Esterase, Group-VIIA Phospholipase A2, gVIIA-PLA2, LDL-Associated Phospholipase A2, LDL-PLA(2), PAF 2-Acylhydrolase, PLA2G7, PAFAH
Accession #	Q13093
Formulation	Supplied as a 0.2 μm filtered solution of 20mM HAc-NaCl, 150mM NaCl, 10% Glycerol, pH 4.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYP SQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSH GLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETH IRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQ TLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITI RGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEG DDENLIPGTNINTTNQHIMLQNSSGIEKYNVDHHHHHH
Background	Platelet-Activating Factor Acetylhydrolase (PAFAH) is a secreted enzyme which belongs to the AB hydrolase superfamily and Lipase family and catalyzes the degradation of platelet-activating factor to biologically inactive products. PAFAH is produced by inflammatory cells and hydrolyzes oxidised phospholipids in LDL. PAFAH has been implicated in the development of atherosclerosis and has also been identified as a marker for cardiac disease. PAFAH might have a major physiologic effect in the presence of inflammatory bodily responses. PAFAH alters the action of PAF by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. PAFAH has specificity for substrates with a short residue at the sn-2 position.