Recombinant Human Proteinase 3/PRTN3/Myeloblastin

Instruction Manual!

Product name:	Recombinant Human Proteinase 3/PRTN3/Myeloblastin
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Proteinase 3 is produced by our Mammalian expression system and the target gene encoding Ala26-Arg249 is expressed with a 6His tag at the C-terminus.
Names	Myeloblastin, AGP7, C-ANCA Antigen, Leukocyte Proteinase 3, PR-3, PR3, Neutrophil Proteinase 4, NP-4, P29, Wegener Autoantigen, PRTN3, MBN
Accession #	P24158
Formulation	Supplied as a 0.2 μm filtered solution of 10mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNV RTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAM GWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFV IWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH
Background	Proteinase-3 is a neutral serine proteinase that belongs to the peptidase S1 family and Elastase subfamily. It contains one peptidase S1 domain and it is expressed mainly in neutrophil granulocytes. The primary function of Proteinase-3 is thought to be degradation of extracellular proteins at sites of inflammation, but excessive or prolonged proteolytic activity may cause harmful effects in the body. It is the epitope of anti-neutrophil cytoplasmic antibodies (ANCAs) of the cANCA (cytoplasmic subtype) class, a type of antibody frequently found in the disease Wegener's granulomatosis.
References	Activation of C3a receptor is required in cigarette smoke-mediated emphysema