Recombinant Human Nectin-3/PVRL3/CD113

Instruction Manual!

Product name:	Recombinant Human Nectin-3/PVRL3/CD113
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Nectin-3 is produced by our Mammalian expression system and the target gene encoding Gly58-Cys366 is expressed with a 6His tag at the C-terminus.
Names	Poliovirus Receptor-Related Protein 3, CDw113, Nectin-3, CD113, PVRL3, PRR3
Accession #	Q9NQS3
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GPIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVL FKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNE TVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHQA LEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLA SDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISAYNSVASLNCVDHHHHHH
Background	Nectin-3 is a type I transmembrane glycoprotein that belongs to the nectin family. Its precursor is 549 amino acids in length and contains an extended signal sequence of 57 amino acids, an extracellular domain (ECD) of 347 amino acids, a transmembrane segment of 21 amino acids, and a cytoplasmic region of 124 amino acids. It is predominantly expressed in testis and placenta as well as in various cell lines, including epithelial cell lines. Nectin-3 plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/Nectin-2 at Sertoli-spermatid junctions. Nectin-3 is also involved in the formation of cell-cell junctions, including adherens junctions and synapses.