Recombinant Human GDP-L-Fucose Synthase/TSTA3/SDR4E1

Instruction Manual!

Product name:	Recombinant Human GDP-L-Fucose Synthase/TSTA3/SDR4E1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human GDP-L-Fucose Synthase is produced by our E.coli expression system and the target gene encoding Met1-Lys321 is expressed with a 6His tag at the C-terminus.
Names	GDP-L-Fucose Synthase, GDP-4-Keto-6-Deoxy-D-Mannose-3,5-Epimerase-4-Reductase, Protein FX, Red Cell NADP(H)-Binding Protein, Short-Chain Dehydrogenase/Reductase Family 4E Member 1, TSTA3, SDR4E1
Accession #	Q13630
Formulation	Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTH VIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETM IHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKV HLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVV EAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARKLEHH HHHH
Background	GDP-L-Fucose Synthase is a NADP(H)-binding protein. It catalyzes the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-dexoymannose to GDP-L-fucose. GDP-L-Fucose is the substrate of several fucosyltransferase, involving the expression of mamy glycoconjugates, including blood group ABH antigens and development adhesion antigens. Mutations in the TSTA3 gene may cause leukocyte adhesion deficiency type II.