elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A

Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A

Instruction Manual!

Product name: Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3/SMT3A
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human SUMO3 is produced by our E.coli expression system and the target gene encoding Met1-Phe103 is expressed with a 6His tag at the N-terminus.
Names Small Ubiquitin-Related Modifier 3, SUMO-3, SMT3 Homolog 1, SUMO-2, Ubiquitin-Like Protein SMT3B, Smt3B, SUMO3, SMT3B, SMT3H1
Accession # P55854
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA YCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Background SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese