Recombinant Human Cytoplasmic Dynein Light Chain 1/DYNLL1

Instruction Manual!

Product name:	Recombinant Human Cytoplasmic Dynein Light Chain 1/DYNLL1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human DYNLL1 is produced by our E.coli expression system and the target gene encoding Met1-Gly89 is expressed with a 6His tag at the N-terminus.
Names	Dynein Light Chain 1 Cytoplasmic, 8 kDa Dynein Light Chain, DLC8, Dynein Light Chain LC8-Type 1, Protein Inhibitor of Neuronal Nitric Oxide Synthase, PIN, DYNLL1,DLC1, DNCL1, DNCLC1, HDLC1
Accession #	P63167
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 1mM DTT, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKE FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Background	Human Dynein Cytoplasmic Light Chain 1 (DYNLL1) has been identified as a protein that interacts with NOS1, leading to NOS1 inhibition. NOS1 dimer is destabilized after binding DYNLL1 a conformation necessary activity, and it regulate numerous biologic processes throughits effects on nitric oxide synthase activity. DYNLL1 is widely expressed, with higher expression in testis and moderate expression in brain.