Recombinant Human EIF1A, X-Chromosomal/EIF1AX
| Product name: | Recombinant Human EIF1A, X-Chromosomal/EIF1AX |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human EIF1AX is produced by our E.coli expression system and the target gene encoding Met1-Ile144 is expressed with a 6His tag at the N-terminus. |
| Names | Eukaryotic Translation Initiation Factor 1A X-Chromosomal, eIF-1A X Isoform, Eukaryotic Translation Initiation Factor 4C, eIF-4C, EIF1AX, EIF1A, EIF4C |
| Accession # | P47813 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNG RLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELP EHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
|
| Background | Eukaryotic Translation Initiation Factor 1A, X-Chromosomal (EIF1AX) is an essential eukaryotic translation initiation factor that belongs to the eIF-1A family. EIF1AX is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA and has been shown to interact with IPO13. EIF1AX contains one S1-like domain and seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits. |












