Recombinant Human Growth Arrest-Specific Protein 7/GAS-7/KIAA0394

Instruction Manual!

Product name:	Recombinant Human Growth Arrest-Specific Protein 7/GAS-7/KIAA0394
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.8.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human GAS-7 is produced by our E.coli expression system and the target gene encoding Met1-Ile412 is expressed with a 6His tag at the N-terminus.
Names	Growth Arrest-Specific Protein 7, GAS-7, GAS7, KIAA0394
Accession #	O60861
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.8.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPS SSPGIPASPGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTI TINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSE FIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPL MNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDI KKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQLRHETD MFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI
Background	Growth Arrest-Specific Protein 7 (GAS7) is expressed primarily in terminalaly differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 may play a role in neuronal development by promoting maturation and morphological differentiation of cerebellar neurons. Inhibition of GAS7 production in terminally differentiating cultures of embryonic murine cerebullum impedes neurite outgrowth. The hyper-expression of GAS7 may play an major role in the initiation and development of huaman osteosarcoma.