elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase/ST8SIA1

Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase/ST8SIA1 Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase/ST8SIA1

Instruction Manual!

Product name: Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase/ST8SIA1
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,pH8.0.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human ST8SIA1 is produced by our Mammalian expression system and the target gene encoding Tyr49-Ser356 is expressed with a 6His tag at the C-terminus.
Names Alpha-N-Acetylneuraminide Alpha-2,8-Sialyltransferase, Alpha-2,8-Sialyltransferase 8A, Ganglioside GD3 Synthase, Ganglioside GT3 Synthase, Sialyltransferase 8A, SIAT8-A, Sialytransferase St8Sia I, ST8SiaI, ST8SIA1, SIAT8, SIAT8A
Accession # Q92185
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,pH8.0.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLY SFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDV GSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVG ANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPIS HHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTSVDHHHHHH
Background α-N-Acetylneuraminide α-2,8-Sialyltransferase (ST8SIA1) belongs to the glycosyltransferase 29 family. ST8SIA1 is a sialytransferase that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce GD3 and GT3. ST8SIA1 is highly expressed in melanoma cell lines, adult and fetal brain, low expressed in adult and fetal lung. ST8SIA1 may act as a type II transmembrane protein with a short N-termianl cytoplasmic domain and a single-pass transmembrane domain folowed by an enzymatic domain in the lument of the Golgi apparatus.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese