Recombinant Human ZW10 Interactor/ZWINT
| Product name: | Recombinant Human ZW10 Interactor/ZWINT |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human ZW10 Interactor is produced by our E.coli expression system and the target gene encoding Met1-Pro277 is expressed with a 6His tag at the N-terminus. |
| Names | ZW10 Interactor, ZW10-Interacting Protein 1, Zwint-1, ZWINT |
| Accession # | O95229 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVD SQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAI KIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVR ERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKP QQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
|
| Background | ZW10 Interactor is localized to the kinetochores from late Prophase to Anaphase and has a uniform distribution in the cytoplasm of Interphase cells. ZWINT interacts ZW10, MIS12 and NDC80 subunit of the NDC80 complex specifically during mitosis. ZWINT is a part of the MIS12 complex which is required for kinetochore formation and spindle checkpoint activity. In addition, ZWINT is required to target ZW10 to the kinetochore at prometaphase. |












