Recombinant Human NAD Kinase/NADK

Instruction Manual!

Product name:	Recombinant Human NAD Kinase/NADK
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, pH 7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human NAD Kinase is produced by our E.coli expression system and the target gene encoding Ser64-Gly446 is expressed with a 6His tag at the N-terminus.
Names	NAD Kinase, Poly(P)/ATP NAD Kinase, NADK
Accession #	O95544
Formulation	Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, pH 7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSV LVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDIS NQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLR SRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVY LDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELK IMLSPEARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKK QAHFEEEEEEEEEG
Background	NAD Kinase (NADK) is an enzyme that belongs to the NAD Kinase family. It is a widely expressed enzyme, but it is not detected in skeletal muscle. NADK converts Nicotinamide Adenine Dinucleotide (NAD+) into NADP+, through phosphorylating the NAD+ coenzyme. NADP+ is an essential coenzyme in metabolism and provides reducing power to biosynthetic processes such as fatty acid biosynthesis. The structure of the NADK from the archaean Archaeoglobus fulgidus has been determined.